Iright
BRAND / VENDOR: Proteintech

Proteintech, 11687-1-AP, DYNLT3 Polyclonal antibody

CATALOG NUMBER: 11687-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DYNLT3 (11687-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLT3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11687-1-AP targets DYNLT3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, HeLa cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Dynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2299 Product name: Recombinant human DYNLT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000968 Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL Predict reactive species Full Name: dynein, light chain, Tctex-type 3 Calculated Molecular Weight: 116 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC000968 Gene Symbol: DYNLT3 Gene ID (NCBI): 6990 RRID: AB_2093777 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51808 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924