Proteintech, 11695-1-AP, HMGN1 Polyclonal antibody

Size: 20ul / 150ul The HMGN1 (11695-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11695-1-AP targets HMGN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HMGN1 (high-mobility group nucleosome-binding protein 1) is a member of the HMG superfamily of nonhistone chromatin-binding proteins, which which regulate chromatin structure and gene transcription. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may participate in the process which maintains transcribable genes in an unique chromatin conformation, and inhibit the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 expressed abundantly Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2315 Product name: Recombinant human HMGN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023984 Sequence: MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD Predict reactive species Full Name: high-mobility group nucleosome binding domain 1 Calculated Molecular Weight: 100 aa, 11 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC023984 Gene Symbol: HMGN1 Gene ID (NCBI): 3150 RRID: AB_2248375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05114 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.