Proteintech, 11716-1-AP, THOC3 Polyclonal antibody

Size: 20ul / 150ul The THOC3 (11716-1-AP) by Proteintech is a Polyclonal antibody targeting THOC3 in WB, IHC, ELISA applications with reactivity to human samples 11716-1-AP targets THOC3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information THOC3 is a component of the nuclear THO transcription elongation complex, which is a part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. Additionally, THOC3 plays a key role in many cellular mechanisms, such as in the pathogenesis of cancer and neurodegenerative diseases (PMID: 36674977). THOC3 has 2 isoforms with the molecular weights of 36 kDa and 39 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2289 Product name: Recombinant human THOC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-348 aa of BC006849 Sequence: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLP Predict reactive species Full Name: THO complex 3 Calculated Molecular Weight: 327 aa, 36 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC006849 Gene Symbol: THOC3 Gene ID (NCBI): 84321 RRID: AB_3085379 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96J01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.