Proteintech, 11723-1-AP, DDX39A Polyclonal antibody

Size: 20ul / 150ul The DDX39A (11723-1-AP) by Proteintech is a Polyclonal antibody targeting DDX39A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11723-1-AP targets DDX39A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes. This antibody may cross-react with DDX39B. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2311 Product name: Recombinant human DDX39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC032128 Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 Calculated Molecular Weight: 427 aa, 49 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC032128 Gene Symbol: DDX39 Gene ID (NCBI): 10212 RRID: AB_10858318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.