Iright
BRAND / VENDOR: Proteintech

Proteintech, 11742-1-AP, SPRR3 Polyclonal antibody

CATALOG NUMBER: 11742-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPRR3 (11742-1-AP) by Proteintech is a Polyclonal antibody targeting SPRR3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11742-1-AP targets SPRR3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human liver tissue Positive IP detected in: COLO 320 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SPRR3, also named as Esophagin, Cornifin beta and SPRC, belongs to the cornifin (SPRR) family. It is cross-linked envelope protein of keratinocytes. Increased expression of SPRR3 appears to be involved in colorectal tumorigenesis. SPRR3 is a marker for terminal squamous cell differentiation.a potential novel therapeutic target for less advanced stages of Breast Cancer. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2337 Product name: Recombinant human SPRR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC017802 Sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK Predict reactive species Full Name: small proline-rich protein 3 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC017802 Gene Symbol: SPRR3 Gene ID (NCBI): 6707 RRID: AB_2195272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924