Iright
BRAND / VENDOR: Proteintech

Proteintech, 11759-1-AP, ZNF395 Polyclonal antibody

CATALOG NUMBER: 11759-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF395 (11759-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF395 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11759-1-AP targets ZNF395 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, HeLa cells, HepG2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZNF395 is a transcription factors binding to a 7bp GC rich sequence which resides in triplicate at intervals of 13bp within and proximal to the -20bp direct repeat sequences of the Htt promoter. It can bind to regulatory regions in papillomaviruses (PV) and subsequently called the protein papillomavirus binding factor (PBF) [PMID: 11853404]. It contains conserved regions CR1, CR2 and CR3, a domain rich in serines and prolines and have the potential to form a zinc-finger structure, and the C-terminal CR3 is responsible for DNA-binding [PMID: 17897615]. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2355 Product name: Recombinant human ZNF395 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-513 aa of BC001237 Sequence: DAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD Predict reactive species Full Name: zinc finger protein 395 Calculated Molecular Weight: 513 aa, 55 kDa Observed Molecular Weight: 62 kDa, 72 kDa GenBank Accession Number: BC001237 Gene Symbol: ZNF395 Gene ID (NCBI): 55893 RRID: AB_2218065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924