Iright
BRAND / VENDOR: Proteintech

Proteintech, 11760-1-AP, HNRNPC Polyclonal antibody

CATALOG NUMBER: 11760-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HNRNPC (11760-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPC in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse colon tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein C (C1/C2) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa, 36-40 kDa GenBank Accession Number: BC003394 Gene Symbol: HNRNPC Gene ID (NCBI): 3183 RRID: AB_2117500 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924