Iright
BRAND / VENDOR: Proteintech

Proteintech, 11770-1-AP, ITLN1/2 Polyclonal antibody

CATALOG NUMBER: 11770-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ITLN1/2 (11770-1-AP) by Proteintech is a Polyclonal antibody targeting ITLN1/2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11770-1-AP targets ITLN1/2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue Positive IP detected in: mouse appendix tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ITLN1, also named as Intelectin 1, has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 is a glycoprotein made up of three 40 kDa subunits cross-linked by disulfide bonds making up a 120-kDa homo-trimer of 295 amino acids and N-linked oligosaccharides (PMID: 17621593). It may play a role in the defense system against microorganisms. Human intelectin-1 is expressed in intestinal goblet cells, and is present at about 200 ng/mL in serum. Intelectin-1 was also shown to be expressed in human endothelial cells and adipocytes of human abdominal adipose tissue. (PMID: 22768319,PMID: 28640441) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2424 Product name: Recombinant human ITLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC020664 Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR Predict reactive species Full Name: intelectin 1 (galactofuranose binding) Calculated Molecular Weight: 313 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC020664 Gene Symbol: ITLN1 Gene ID (NCBI): 55600 RRID: AB_2129677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924