Iright
BRAND / VENDOR: Proteintech

Proteintech, 11800-1-AP, POPDC3 Polyclonal antibody

CATALOG NUMBER: 11800-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POPDC3 (11800-1-AP) by Proteintech is a Polyclonal antibody targeting POPDC3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11800-1-AP targets POPDC3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse heart tissue, human skeletal muscle tissue, human placenta tissue, human testis tissue, human spleen tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The Popeye domain-containing (POPDC) gene family includes BVES/POPDC1, POPDC2 and POPDC3. POPDC proteins are highly evolutionarily conserved transmembrane proteins expressed in embryonic epithelium, heart and muscle. POPDC3 is a 291-amino acid protein containing three putative transmembrane domains. It has been reported that POPDC3 expression is reduced in gastric cancer, suggesting it might play an important role in the progression and metastases of gastric cancer. (PMID: 10882522; 20627872; 22654436) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2375 Product name: Recombinant human POPDC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC022323 Sequence: MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK Predict reactive species Full Name: popeye domain containing 3 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC022323 Gene Symbol: POPDC3 Gene ID (NCBI): 64208 RRID: AB_2166494 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924