Iright
BRAND / VENDOR: Proteintech

Proteintech, 11803-1-AP, S100P Polyclonal antibody

CATALOG NUMBER: 11803-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100P (11803-1-AP) by Proteintech is a Polyclonal antibody targeting S100P in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11803-1-AP targets S100P in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells Positive IHC detected in: human pancreas cancer tissue, human bowen disease tissue, human colon cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2379 Product name: Recombinant human S100P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species Full Name: S100 calcium binding protein P Calculated Molecular Weight: 95 aa, 11 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC006819 Gene Symbol: S100P Gene ID (NCBI): 6286 RRID: AB_2184577 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25815 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924