Iright
BRAND / VENDOR: Proteintech

Proteintech, 11811-1-AP, SIRP beta 1/CD172b Polyclonal antibody

CATALOG NUMBER: 11811-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIRP beta 1/CD172b (11811-1-AP) by Proteintech is a Polyclonal antibody targeting SIRP beta 1/CD172b in WB, ELISA applications with reactivity to human samples 11811-1-AP targets SIRP beta 1/CD172b in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, A375 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2478 Product name: Recombinant human SIRPB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC025286 Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA Predict reactive species Full Name: signal-regulatory protein beta 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC025286 Gene Symbol: SIRPB1 Gene ID (NCBI): 10326 RRID: AB_2188197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924