Iright
BRAND / VENDOR: Proteintech

Proteintech, 11813-1-AP, CILP2 Polyclonal antibody

CATALOG NUMBER: 11813-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CILP2 (11813-1-AP) by Proteintech is a Polyclonal antibody targeting CILP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 11813-1-AP targets CILP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, SW480 cells, mouse brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CILP2, also named as Cartilage intermediate layer protein 2, is a 1156 amino acid protein, which is expressed in articular chondrocytes but not in knee meniscal cartilage cells. CILP2 localizes to the intermediate to deep zone of articular cartilage. CILP2 may play a role in cartilage scaffolding. Given the full-length molecular mass of CILP2 is 125 kDa, but the most CILP2 protein in articular cartilage is cleaved,mostly likely at the furin cleavage site. CILP2 protein is detected as a major band on SDS-page migrating at about 90 kDa. (PMID: 21880736) Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2366 Product name: Recombinant human CILP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 304-653 aa of BC034926 Sequence: ALVTATLGGEELEPAPSLPRPLPATVGVTQPYLDRLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFARVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGGSHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEAAQAQARASGPLRTRRGRVRQ Predict reactive species Full Name: cartilage intermediate layer protein 2 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC034926 Gene Symbol: CILP2 Gene ID (NCBI): 148113 RRID: AB_2877795 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924