Iright
BRAND / VENDOR: Proteintech

Proteintech, 11819-1-AP, C4BPA Polyclonal antibody

CATALOG NUMBER: 11819-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C4BPA (11819-1-AP) by Proteintech is a Polyclonal antibody targeting C4BPA in WB, IHC, ELISA applications with reactivity to human samples 11819-1-AP targets C4BPA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue, human plasma tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information C4b-binding protein (C4BP) is a large oligomeric glycoprotein, present in plasma at a concentration of approximately 200 mg/L (PMID: 24218259). It is the main inhibitor of the classical complement and lectin pathway. C4BP is composed of two polypeptides (alpha and beta chains), which have molecular weights of 70 and 45 kDa, respectively (PMID: 7561113). This polyclonal antibody is raised against the C4BP alpha chain (C4BPA). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2387 Product name: Recombinant human C4BPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-597 aa of BC022312 Sequence: PSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL Predict reactive species Full Name: complement component 4 binding protein, alpha Calculated Molecular Weight: 597 aa, 67 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC022312 Gene Symbol: C4BPA Gene ID (NCBI): 722 RRID: AB_2877796 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924