Proteintech, 11824-1-AP, CDC42EP2 Polyclonal antibody

Size: 20ul / 150ul The CDC42EP2 (11824-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42EP2 in WB, ELISA applications with reactivity to human, mouse samples 11824-1-AP targets CDC42EP2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2392 Product name: Recombinant human CDC42EP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC022337 Sequence: MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT Predict reactive species Full Name: CDC42 effector protein (Rho GTPase binding) 2 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC022337 Gene Symbol: CDC42EP2 Gene ID (NCBI): 10435 RRID: AB_10793663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.