Proteintech, 11850-1-AP, Surfactant Protein A Polyclonal antibody

Size: 20ul / 150ul The Surfactant Protein A (11850-1-AP) by Proteintech is a Polyclonal antibody targeting Surfactant Protein A in IHC, ELISA applications with reactivity to human samples 11850-1-AP targets Surfactant Protein A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung tissue, human heart tissue, human kidney tissue, human placenta tissue, human skin tissue, human brain tissue, human spleen tissue, human ovary tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2). Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2417 Product name: Recombinant human SFTPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-248 aa of BC026229 Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF Predict reactive species Full Name: surfactant protein A1 Calculated Molecular Weight: 248 aa, 26 kDa GenBank Accession Number: BC026229 Gene Symbol: Surfactant Protein A Gene ID (NCBI): 653509 RRID: AB_2185360 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.