Iright
BRAND / VENDOR: Proteintech

Proteintech, 11864-1-AP, MS4A7 Polyclonal antibody

CATALOG NUMBER: 11864-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MS4A7 (11864-1-AP) by Proteintech is a Polyclonal antibody targeting MS4A7 in WB, ELISA applications with reactivity to human, mouse samples 11864-1-AP targets MS4A7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BV-2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The human MS4A family currently includes 18 members, and these proteins have four putative transmembrane domains (tetraspan) and several protein kinase C (PKC) phosphorylation sites. Membrane-spanning 4-domains a7 (MS4A7) is a member of the MS4A family. It is expressed by myeloid cells. MS4A7 can act as a NAM-specific pathogenic factor that exacerbates metabolic dysfunction-associated steatohepatitis (MASH) progression in mice (PMID: 38478630). There are two isoforms of MS4A7 protein, with molecular weights of 26.14 kDa and 21.41 kDa respectively. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2442 Product name: Recombinant human MS4A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC020673 Sequence: MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI Predict reactive species Full Name: membrane-spanning 4-domains, subfamily A, member 7 Calculated Molecular Weight: 240 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC020673 Gene Symbol: MS4A7 Gene ID (NCBI): 58475 RRID: AB_2144674 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924