Iright
BRAND / VENDOR: Proteintech

Proteintech, 11884-1-AP, GNGT1 Polyclonal antibody

CATALOG NUMBER: 11884-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GNGT1 (11884-1-AP) by Proteintech is a Polyclonal antibody targeting GNGT1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 11884-1-AP targets GNGT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information G protein subunit gamma-T1(GNGT1) is encoded by the transducin gamma-subunit gene, which localized on huaman chromosome 7q21.3, participating in various transmembrane signaling systems. Particularly, GNGT1 gene is specific to retinal rod photoreceptors. Present polyclonal anti-GNGT1 antibody (11884-1-AP) is produced by immunizing rabbits with full-length chain of GNGT1 and dectects an 8 kDa band in mouse retinal tissue. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2488 Product name: Recombinant human GNGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC029367 Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 Calculated Molecular Weight: 74 aa, 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC029367 Gene Symbol: GNGT1 Gene ID (NCBI): 2792 RRID: AB_10858628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924