Iright
BRAND / VENDOR: Proteintech

Proteintech, 11892-1-AP, APOH Polyclonal antibody

CATALOG NUMBER: 11892-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APOH (11892-1-AP) by Proteintech is a Polyclonal antibody targeting APOH in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11892-1-AP targets APOH in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse testis tissue Positive IHC detected in: human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins. ApoH is a 54 kDa plasma glycoprotein. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2500 Product name: Recombinant human APOH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-345 aa of BC026283 Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC Predict reactive species Full Name: apolipoprotein H (beta-2-glycoprotein I) Calculated Molecular Weight: 345 aa, 38 kDa Observed Molecular Weight: 43-55 kDa GenBank Accession Number: BC026283 Gene Symbol: APOH Gene ID (NCBI): 350 RRID: AB_2058267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924