Proteintech, 11918-1-AP, ICAM4 Polyclonal antibody

Size: 20ul / 150ul The ICAM4 (11918-1-AP) by Proteintech is a Polyclonal antibody targeting ICAM4 in WB, ELISA applications with reactivity to human samples 11918-1-AP targets ICAM4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse eye tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42kd glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2544 Product name: Recombinant human ICAM4 protein Source: e coli. -derived, T-GST Tag: GST Domain: 1-271 aa of BC029364 Sequence: MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA Predict reactive species Full Name: intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) Calculated Molecular Weight: 271 aa, 29 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC029364 Gene Symbol: ICAM4 Gene ID (NCBI): 3386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14773 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.