Proteintech, 11922-1-AP, LYZL6 Polyclonal antibody

Size: 20ul / 150ul The LYZL6 (11922-1-AP) by Proteintech is a Polyclonal antibody targeting LYZL6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11922-1-AP targets LYZL6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2569 Product name: Recombinant human LYZL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC054481 Sequence: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR Predict reactive species Full Name: lysozyme-like 6 Calculated Molecular Weight: 148 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC054481 Gene Symbol: LYZL6 Gene ID (NCBI): 57151 RRID: AB_10926387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75951 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.