Iright
BRAND / VENDOR: Proteintech

Proteintech, 11924-1-AP, Calcyphosine 2 Polyclonal antibody

CATALOG NUMBER: 11924-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Calcyphosine 2 (11924-1-AP) by Proteintech is a Polyclonal antibody targeting Calcyphosine 2 in WB, ELISA applications with reactivity to human samples 11924-1-AP targets Calcyphosine 2 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information CAPS2 protein contains 2 EF-hand Ca(2+)-binding motifs. Northern blot analysis detected expression of CAPS2 in all tissues tested except prostate, spleen, and small intestine. Highest expression was found in colon, testis, lung, placenta, and brain. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2571 Product name: Recombinant human CAPS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC056672 Sequence: MIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKIRTHSTLTENVLSHKLQFDGRIVSRTNVLPFIQKSIYSHQCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG Predict reactive species Full Name: calcyphosine 2 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC056672 Gene Symbol: Calcyphosine 2 Gene ID (NCBI): 84698 RRID: AB_878013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924