Iright
BRAND / VENDOR: Proteintech

Proteintech, 11934-1-AP, ARL15 Polyclonal antibody

CATALOG NUMBER: 11934-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARL15 (11934-1-AP) by Proteintech is a Polyclonal antibody targeting ARL15 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11934-1-AP targets ARL15 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue Positive IP detected in: mouse thymus tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ARL15(ADP-ribosylation factor-like protein 15) is also named as ARFRP2(ADP-ribosylation factor-related protein 2) and belongs to the small GTPase superfamily and Arf familiy.ADP-ribosylation factor-related protein (ARP) is a membrane-associated GTPase with remote similarity to the family of ADP-ribosylation factors (ARF)(PMID:10092663). Arl15 is present in chordates but not lower eukaryotes. Arl15 lacks a site for Nmyristoylation, but the N-terminal region contains several well-conserved cysteines, suggesting that it may bepalmitoylated(PMID:17506703). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2530 Product name: Recombinant human ARL15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC026093 Sequence: MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM Predict reactive species Full Name: ADP-ribosylation factor-like 15 Calculated Molecular Weight: 204 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC026093 Gene Symbol: ARL15 Gene ID (NCBI): 54622 RRID: AB_2227438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924