Iright
BRAND / VENDOR: Proteintech

Proteintech, 11937-1-AP, MAPKSP1 Polyclonal antibody

CATALOG NUMBER: 11937-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAPKSP1 (11937-1-AP) by Proteintech is a Polyclonal antibody targeting MAPKSP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11937-1-AP targets MAPKSP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, L02 cells, mouse brain tissue, mouse liver tissue Positive IHC detected in: human prostate cancer tissue, human heart tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MAPKSP1, also named as mitogen activated protein kinase kinase 1 interacting protein 1, Map2k1ip1, MEK partner 1, Lamtor3 and MP1. It was first identified as a scaffold protein enhancing the efficiency of the MAPK pathway by facilitating the interaction between MEK1 and ERK1 upon serum stimulation (PMID: 9733512). Later, it has been demonstrated that MAPKSP1 enhances activation of both ERK1 and ERK2 as a response to EGF (PMID: 12479806) and fibronectin (PMID: 15923628). MAPKSP1 is involved in regulating endosomal signaling (PMID: 17178906), and a role in cancer, via MEK and ERK hyperactivation, has been demostrated in pancreatic tumorigenesis (PMID: 24209743). MAPKSP1 has two isoforms with the molecular weight of 13-14 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2534 Product name: Recombinant human MAPKSP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC026245 Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS Predict reactive species Full Name: MAPK scaffold protein 1 Calculated Molecular Weight: 124 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC026245 Gene Symbol: MAPKSP1 Gene ID (NCBI): 8649 RRID: AB_2141610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHA4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924