Proteintech, 11944-1-AP, STEAP4 Polyclonal antibody

Size: 20ul / 150ul The STEAP4 (11944-1-AP) by Proteintech is a Polyclonal antibody targeting STEAP4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 11944-1-AP targets STEAP4 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, 3T3-L1 cells, rat liver tissue, human liver tissue, human brain tissue, RAW 264.7 cells Positive IP detected in: 3T3-L1 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2545 Product name: Recombinant human STEAP4 protein Source: e coli. -derived, T-GST Tag: GST Domain: 1-283 aa of BC020600 Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH Predict reactive species Full Name: STEAP family member 4 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC020600 Gene Symbol: STEAP4 Gene ID (NCBI): 79689 RRID: AB_2197868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q687X5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.