Proteintech, 11947-1-AP, RAB5A Polyclonal antibody

Size: 20ul / 150ul The RAB5A (11947-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5A in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11947-1-AP targets RAB5A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, mouse brain tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2549 Product name: Recombinant human RAB5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species Full Name: RAB5A, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001267 Gene Symbol: RAB5A Gene ID (NCBI): 5868 RRID: AB_2269388 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20339 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.