Proteintech, 11961-1-AP, PAGE2 Polyclonal antibody

Size: 20ul / 150ul The PAGE2 (11961-1-AP) by Proteintech is a Polyclonal antibody targeting PAGE2 in IHC, ELISA applications with reactivity to human samples 11961-1-AP targets PAGE2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2566 Product name: Recombinant human PAGE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC054022 Sequence: MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP Predict reactive species Full Name: P antigen family, member 2 (prostate associated) Calculated Molecular Weight: 12 kDa GenBank Accession Number: BC054022 Gene Symbol: PAGE2 Gene ID (NCBI): 203569 RRID: AB_2877808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z2X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.