Iright
BRAND / VENDOR: Proteintech

Proteintech, 11972-2-AP, TIPIN Polyclonal antibody

CATALOG NUMBER: 11972-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TIPIN (11972-2-AP) by Proteintech is a Polyclonal antibody targeting TIPIN in WB, ELISA applications with reactivity to human, mouse, rat samples 11972-2-AP targets TIPIN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TIPIN, also named as TIMELESS-interacting protein, is a 301 amino acid protein, which belongs to the CSM3 family. TIPIN Plays an important role in the control of DNA replication and the maintenance of replication fork stability. TIPIN forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress. The calculated molecular weight of TIPIN is 34 kDa, but the result of WB is 55-60 kDa, which is similar to the result of publication.(PMID: 24830473) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2595 Product name: Recombinant human TIPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC000870 Sequence: MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVPVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR Predict reactive species Full Name: TIMELESS interacting protein Calculated Molecular Weight: 301 aa, 34 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000870 Gene Symbol: TIPIN Gene ID (NCBI): 54962 RRID: AB_2205116 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924