Iright
BRAND / VENDOR: Proteintech

Proteintech, 11993-1-AP, TCEAL1 Polyclonal antibody

CATALOG NUMBER: 11993-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCEAL1 (11993-1-AP) by Proteintech is a Polyclonal antibody targeting TCEAL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 11993-1-AP targets TCEAL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TCEAL1 is homologous to TFIIS, a conserved eukaryotic transcription elongation factor. The predicted 157-amino acid protein has a calculated molecular mass of 21 kD.On Western blots of mammalian cell extracts,it migrated as a 27-kD protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2653 Product name: Recombinant human TCEAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC000809 Sequence: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI Predict reactive species Full Name: transcription elongation factor A (SII)-like 1 Calculated Molecular Weight: 159 aa, 21 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC000809 Gene Symbol: TCEAL1 Gene ID (NCBI): 9338 RRID: AB_2877814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15170 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924