Proteintech, 12000-1-AP, CCL5/RANTES Polyclonal antibody

Size: 20ul / 150ul The CCL5/RANTES (12000-1-AP) by Proteintech is a Polyclonal antibody targeting CCL5/RANTES in WB, ELISA applications with reactivity to human samples 12000-1-AP targets CCL5/RANTES in WB, IHC, IF, Neutralization, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets, PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2617 Product name: Recombinant human CCL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC008600 Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Predict reactive species Full Name: chemokine (C-C motif) ligand 5 Calculated Molecular Weight: 91 aa, 10 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC008600 Gene Symbol: CCL5/RANTES Gene ID (NCBI): 6352 RRID: AB_2877815 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13501 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.