Iright
BRAND / VENDOR: Proteintech

Proteintech, 12015-1-AP, NDRG2 Polyclonal antibody

CATALOG NUMBER: 12015-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDRG2 (12015-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12015-1-AP targets NDRG2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HepG2 cells, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDRG2, or N-myc downstream-regulated gene 2, is a tumor suppressor gene that plays a significant role in cancer development and progression. It is associated with tumor incidence, progression, and metastasis, and is known to regulate tumor-associated genes. NDRG2 is part of the NDRG family, which includes NDRG1, NDRG2, NDRG3, and NDRG4. These proteins are characterized by an esterase/lipase/thioesterase active site serine and an α/β hydrolase fold of approximately 220 amino acids, although they do not exhibit enzyme activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2629 Product name: Recombinant human NDRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC010458 Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC Predict reactive species Full Name: NDRG family member 2 Calculated Molecular Weight: 371 aa, 39 kDa Observed Molecular Weight: 41-43 kDa GenBank Accession Number: BC010458 Gene Symbol: NDRG2 Gene ID (NCBI): 57447 RRID: AB_10666856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924