Iright
BRAND / VENDOR: Proteintech

Proteintech, 12020-1-AP, SPATA7 Polyclonal antibody

CATALOG NUMBER: 12020-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPATA7 (12020-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12020-1-AP targets SPATA7 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SPATA7, also named as HSD3, may be involved in retinal function. It is interesting to note that mutations in SPATA7 cause LCA and RP/ARRP , two overlapping but distinct human retinal diseases. SPATA7 is another LCA and Juvenile RP Gene.(PMID:19268277) It is a highly conserved, vertebrate-specific protein which expressed in the mature retina. For some modification, the MW always migrate 5-8kd. The antibody can reoginze all the 3 isoforms of SPATA7. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2649 Product name: Recombinant human SPATA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-468 aa of BC008656 Sequence: SFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV Predict reactive species Full Name: spermatogenesis associated 7 Calculated Molecular Weight: 599 aa, 68 kDa Observed Molecular Weight: 68-80 kDa GenBank Accession Number: BC008656 Gene Symbol: SPATA7 Gene ID (NCBI): 55812 RRID: AB_2195380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0W8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924