Proteintech, 12030-1-AP, WBP2 Polyclonal antibody

Size: 20ul / 150ul The WBP2 (12030-1-AP) by Proteintech is a Polyclonal antibody targeting WBP2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12030-1-AP targets WBP2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HEK-293 cells, MCF-7 cells, MDA-MB-453s cells Positive IP detected in: A375 cells Positive IHC detected in: mouse testis tissue, human breast cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2661 Product name: Recombinant human WBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC010616 Sequence: MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ Predict reactive species Full Name: WW domain binding protein 2 Calculated Molecular Weight: 261 aa, 28 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC010616 Gene Symbol: WBP2 Gene ID (NCBI): 23558 RRID: AB_11183770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969T9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.