Iright
BRAND / VENDOR: Proteintech

Proteintech, 12138-1-AP, LSM6 Polyclonal antibody

CATALOG NUMBER: 12138-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LSM6 (12138-1-AP) by Proteintech is a Polyclonal antibody targeting LSM6 in IHC, ELISA applications with reactivity to human samples 12138-1-AP targets LSM6 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LSM6 plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PMID: 28781166). LSM6 is a component of LSm protein complexes, and LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA (PMID: 10523320). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2784 Product name: Recombinant human LSM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016026 Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM Predict reactive species Full Name: LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) Calculated Molecular Weight: 80 aa, 9 kDa GenBank Accession Number: BC016026 Gene Symbol: LSM6 Gene ID (NCBI): 11157 RRID: AB_2616314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62312 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924