Iright
BRAND / VENDOR: Proteintech

Proteintech, 12163-1-AP, GOPC Polyclonal antibody

CATALOG NUMBER: 12163-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GOPC (12163-1-AP) by Proteintech is a Polyclonal antibody targeting GOPC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12163-1-AP targets GOPC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-3 cells, mouse colon Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293T cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GOPC (FIG/PIST/CAL) is a PDZ-domain scaffolding protein that regulates the trafficking of many integral membrane proteins, including cell surface receptors, ion channels and adhesion molecules. GOPC localizes to the trans-Golgi network (TGN) but not to the cis- or trans-Golgi cisternae, thus anti-GOPC can be used to label the TGN structure. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2804 Product name: Recombinant human GOPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-370 aa of BC009553 Sequence: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDD Predict reactive species Full Name: golgi associated PDZ and coiled-coil motif containing Calculated Molecular Weight: 454 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC009553 Gene Symbol: GOPC Gene ID (NCBI): 57120 RRID: AB_2113182 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HD26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924