Proteintech, 12176-1-AP, FAM107A Polyclonal antibody

Size: 20ul / 150ul The FAM107A (12176-1-AP) by Proteintech is a Polyclonal antibody targeting FAM107A in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12176-1-AP targets FAM107A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information FAM107A, also named as TU3A, encodes a 144 amino-acid protein, which contains a coiled-coil domain and a nuclear localization signal. FAM107A as a transcription factor regulates some gene transcription and signal transduction in cell. With the exception of peripheral blood cells, FAM107A is widely expressed in normal tissues, but shows significant loss of expression in renal cell carcinomas and frequent loss of expression in cervical, gastric, ovarian and non small cell lung cancers. Transfection of FAM107A mRNA into cancer cell line inhibits cell growth and proliferation, supporting the evidence that the gene functions as an important tumor suppressor. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2820 Product name: Recombinant human FAM107A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC010561 Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL Predict reactive species Full Name: family with sequence similarity 107, member A Calculated Molecular Weight: 144 aa, 17 kDa GenBank Accession Number: BC010561 Gene Symbol: FAM107A Gene ID (NCBI): 11170 RRID: AB_2877832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95990 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.