Iright
BRAND / VENDOR: Proteintech

Proteintech, 12179-1-AP, MT3 Polyclonal antibody

CATALOG NUMBER: 12179-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MT3 (12179-1-AP) by Proteintech is a Polyclonal antibody targeting MT3 in IHC, ELISA applications with reactivity to human, mouse, rat samples 12179-1-AP targets MT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, human brain tissue, human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MT3(Metallothionein-3) is also names as GIF(Growth inhibitory factor),GIFB inhibits N-glycosylation of IgE-binding factors and that unglycosylated IgE-binding factors selectively suppressed IgE synthesis.The major cell source of GIF is antigen-specific suppressor T(Ts)cell(PMID:10967025).The molecular size of GIF from T cells is 15 kDa, while GIF from macrophages consisted of 40-and 15-kDa molecules(PMID:2417235). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2823 Product name: Recombinant human MT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013081 Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ Predict reactive species Full Name: metallothionein 3 Calculated Molecular Weight: 68 aa, 7 kDa GenBank Accession Number: BC013081 Gene Symbol: MT3 Gene ID (NCBI): 4504 RRID: AB_2146645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25713 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924