Product Description
Size: 20ul / 150ul
The MT3 (12179-1-AP) by Proteintech is a Polyclonal antibody targeting MT3 in IHC, ELISA applications with reactivity to human, mouse, rat samples
12179-1-AP targets MT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse brain tissue, human brain tissue, human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
MT3(Metallothionein-3) is also names as GIF(Growth inhibitory factor),GIFB inhibits N-glycosylation of IgE-binding factors and that unglycosylated IgE-binding factors selectively suppressed IgE synthesis.The major cell source of GIF is antigen-specific suppressor T(Ts)cell(PMID:10967025).The molecular size of GIF from T cells is 15 kDa, while GIF from macrophages consisted of 40-and 15-kDa molecules(PMID:2417235).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: mouse, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2823 Product name: Recombinant human MT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013081 Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ Predict reactive species
Full Name: metallothionein 3
Calculated Molecular Weight: 68 aa, 7 kDa
GenBank Accession Number: BC013081
Gene Symbol: MT3
Gene ID (NCBI): 4504
RRID: AB_2146645
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P25713
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924