Proteintech, 12197-1-AP, WWP2 Polyclonal antibody

Size: 20ul / 150ul The WWP2 (12197-1-AP) by Proteintech is a Polyclonal antibody targeting WWP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12197-1-AP targets WWP2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, NIH/3T3 cells, HSC-T6 cells Positive IP detected in: A549 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information WWP2(WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes(PMID:21532586).WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells(PMID:15047715). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2835 Product name: Recombinant human WWP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC013645 Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT Predict reactive species Full Name: WW domain containing E3 ubiquitin protein ligase 2 Calculated Molecular Weight: 870 aa, 99 kDa Observed Molecular Weight: 110-115 kDa GenBank Accession Number: BC013645 Gene Symbol: WWP2 Gene ID (NCBI): 11060 RRID: AB_10597536 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00308 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.