Iright
BRAND / VENDOR: Proteintech

Proteintech, 12206-1-AP, Syntaxin 8 Polyclonal antibody

CATALOG NUMBER: 12206-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Syntaxin 8 (12206-1-AP) by Proteintech is a Polyclonal antibody targeting Syntaxin 8 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12206-1-AP targets Syntaxin 8 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, A375 cells, human brain tissue, human kidney tissue, human liver tissue, human lung tissue, human placenta tissue, mouse pancreas tissue Positive IP detected in: A375 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Syntaxin 8 (STX8), also known as CIP-1-associated regulator of cyclin B (CARB ), is a protein belonging to the syntaxin family. The gene of STX8 maps to chromosomal band 17p12 and it encodes a 236-amino-acid protein containing 1 t-SNARE coiled-coil homology domain. STX8 mRNA is broadly expressed in multiple human tissues, including the heart, brain, kidney, liver, lung, placenta, skeletal muscle, spleen, and pancreas (PMID: 10198254). STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2850 Product name: Recombinant human STX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC009713 Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKS Predict reactive species Full Name: syntaxin 8 Calculated Molecular Weight: 236 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC009713 Gene Symbol: Syntaxin 8 Gene ID (NCBI): 9482 RRID: AB_2196671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924