Iright
BRAND / VENDOR: Proteintech

Proteintech, 12213-1-AP, MARCH5 Polyclonal antibody

CATALOG NUMBER: 12213-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MARCH5 (12213-1-AP) by Proteintech is a Polyclonal antibody targeting MARCH5 in WB, IHC, ELISA applications with reactivity to human samples 12213-1-AP targets MARCH5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U-937 cells Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MARCH5(E3 ubiquitin-protein ligase MARCH5) is a 31 kDa protein also named as RNF153. This protein plays a protective role against mitochondrial dysfunction caused by the mitochondrial accumulation of mSOD1 via the ubiquitin-proteasome pathway (PMID:19741096). And it may regulate MAP1B LC1 function in mitochondria by controlling mitochondrial aggregation via mitochondrial LC1 levels(PMID:22308378). MEARCH5 can exsit as a homodimer with MW 65-70 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2806 Product name: Recombinant human MARCH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC015480 Sequence: MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRI Predict reactive species Full Name: membrane-associated ring finger (C3HC4) 5 Calculated Molecular Weight: 278 aa, 31 kDa Observed Molecular Weight: 31 kDa, 65-70 kDa GenBank Accession Number: BC015480 Gene Symbol: MARCH5 Gene ID (NCBI): 54708 RRID: AB_10638602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924