Proteintech, 12226-1-AP, SH2B1 Polyclonal antibody

Size: 20ul / 150ul The SH2B1 (12226-1-AP) by Proteintech is a Polyclonal antibody targeting SH2B1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12226-1-AP targets SH2B1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human ovary cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SH2B1 is a member of the SH2-domain containing mediators family. SH2B1 has been shown to interact with INS receptor, Grb2, TrkA and Janus kinase 2. Variations close to or in the SH2B1 gene have been found to associate with obesity in two large genome wide association studies of body mass index (PMID: 19079260). SH2B1deletions are associated with severe early-onset obesity (PMID: 19966786). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2863 Product name: Recombinant human SH2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC010704 Sequence: MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQ Predict reactive species Full Name: SH2B adaptor protein 1 Calculated Molecular Weight: 426 aa, 45 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC010704 Gene Symbol: SH2B1 Gene ID (NCBI): 25970 RRID: AB_2877838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.