Proteintech, 12235-1-AP, NR4A1 Polyclonal antibody

Size: 20ul / 150ul The NR4A1 (12235-1-AP) by Proteintech is a Polyclonal antibody targeting NR4A1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12235-1-AP targets NR4A1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, L02 cells, mouse liver tissue, rat liver tissue, PC-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse colon tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NR4A1 is an orphan nuclear receptor that act concomitantly with NURR1 in regulating the expression of delay-early genes during liver regeneration. Also NR4A1 has linked not only to cell apoptosis but also proliferation in response to growth factor. It plays a role in caspase-independent cell death by activation of the ERK pathway and increased activity of MEF2 transcription factors. NR4A1 exists some isoforms with MW 65 and 34 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2875 Product name: Recombinant human NR4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-598 aa of BC016147 Sequence: KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF Predict reactive species Full Name: nuclear receptor subfamily 4, group A, member 1 Calculated Molecular Weight: 598 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC016147 Gene Symbol: NR4A1 Gene ID (NCBI): 3164 RRID: AB_10644125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.