Iright
BRAND / VENDOR: Proteintech

Proteintech, 12238-1-AP, MKRN2 Polyclonal antibody

CATALOG NUMBER: 12238-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MKRN2 (12238-1-AP) by Proteintech is a Polyclonal antibody targeting MKRN2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12238-1-AP targets MKRN2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells, K-562 cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MKRN2(Probable E3 ubiquitin-protein ligase makorin-2) is also named as RNF62. It is an E3 ubiquitin ligase that catalyzes the covalent attachment of ubiquitin moieties onto substrate proteins. It may be playing a functional role in negatively regulating neurogenesis via PI3K/Akt signaling. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2881 Product name: Recombinant human MKRN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-416 aa of BC015715 Sequence: GTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP Predict reactive species Full Name: makorin ring finger protein 2 Calculated Molecular Weight: 416 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC015715 Gene Symbol: MKRN2 Gene ID (NCBI): 23609 RRID: AB_2142636 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H000 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924