Iright
BRAND / VENDOR: Proteintech

Proteintech, 12242-1-AP, SLC12A8 Polyclonal antibody

CATALOG NUMBER: 12242-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC12A8 (12242-1-AP) by Proteintech is a Polyclonal antibody targeting SLC12A8 in WB, ELISA applications with reactivity to human, mouse samples 12242-1-AP targets SLC12A8 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 37°C incubated mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Solute carrier family 12 member 8 (SLC12A8) belongs to the SLC12 gene family, which consists of electroneutral cation-chloride coupled cotransporters. It is highly expressed in small intestine and pancreas and moderately expressed in liver and white adipose tissue (PMID: 31131364). SLC12A8 may be a useful biomarker for the early diagnosis and treatment of bladder cancer (PMID: 33364434). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2886 Product name: Recombinant human SLC12A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 409-714 aa of BC020506 Sequence: SCSLTPVPEPVLREGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQGEGNRTPESQKRKSKKATKQTLQDSFLLDLKSPPSFPVEISDRLPAASWEGQESCWNKQTSKSEGTQPEGTYGEQLVPELCNQSESSGEDFFLKSRLQEQDVWRRSTSFYTHMCNPWVSLLGAVGSLLIMFVIQWVYTLVNMGVAAIVYFYIGRASPGLHLGSASNFSFFRWMRSLLLPSCRSLQSPQEQIILAPSLAKVDMEMTQLTQENADFATRDRYHHSSLVNREQLMPHY Predict reactive species Full Name: solute carrier family 12 (potassium/chloride transporters), member 8 Calculated Molecular Weight: 714 aa, 80 kDa Observed Molecular Weight: 70 KDa GenBank Accession Number: BC020506 Gene Symbol: SLC12A8 Gene ID (NCBI): 84561 RRID: AB_3669135 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0AV02 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924