Proteintech, 12244-1-AP, NELF Polyclonal antibody

Size: 20ul / 150ul The NELF (12244-1-AP) by Proteintech is a Polyclonal antibody targeting NELF in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12244-1-AP targets NELF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, human colon tissue, mouse testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NSMF has some isoforms with MW 44 kDa and 55-60 kDa. This antibody recognizes all the isoforms. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2888 Product name: Recombinant human NELF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC016862 Sequence: ERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKGLEAVACDTEGFVPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIERKLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL Predict reactive species Full Name: nasal embryonic LHRH factor Calculated Molecular Weight: 507 aa, 56 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC016862 Gene Symbol: NELF Gene ID (NCBI): 26012 RRID: AB_2150819 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6X4W1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.