Proteintech, 12255-1-AP, RCAS1 Polyclonal antibody

Size: 20ul / 150ul The RCAS1 (12255-1-AP) by Proteintech is a Polyclonal antibody targeting RCAS1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12255-1-AP targets RCAS1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse heart tissue, rat heart tissue Positive IP detected in: HeLa cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:600-1:2400 Background Information Estrogen receptor-binding fragment-associated antigen 9 (EBAG9) gene was identified as an estrogen-responsive gene. The gene product, receptor-binding cancer antigen expressed on SiSo cells (RCAS1), is associated with aggressive characteristics and poor overall survival for 15 different human malignancies. The correlation between RCAS1 expression and several clinicopathological variables, including tumor size, clinical stage, invasion depth and lymph node metastasis highlights this molecule's clinical significance. Expression of RCAS1 in tumor cells plays an important role in evasion from host immune system resulting tumor progression, invasion and metastasis. Further exploration of RCAS1 biological function will facilitate development of novel therapeutic strategies that target RCAS1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2905 Product name: Recombinant human EBAG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC017729 Sequence: MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS Predict reactive species Full Name: estrogen receptor binding site associated, antigen, 9 Calculated Molecular Weight: 213 aa, 24 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC017729 Gene Symbol: RCAS1 Gene ID (NCBI): 9166 RRID: AB_2246420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00559 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.