Iright
BRAND / VENDOR: Proteintech

Proteintech, 12293-1-AP, TSPAN6 Polyclonal antibody

CATALOG NUMBER: 12293-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPAN6 (12293-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN6 in WB, ELISA applications with reactivity to human, mouse, rat samples 12293-1-AP targets TSPAN6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TSPAN6 (also known as TM4SF6) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN6 gene is widely expressed, with high mRNA levels in liver, pancreas, kidney, and ovary (PMID: 9782095). TSPAN6 has been reported as a negative regulator of the RLR pathway by interacting with MAVS in a ubiquitination-dependent manner (PMID: 22908223). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2964 Product name: Recombinant human TSPAN6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC012389 Sequence: MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV Predict reactive species Full Name: tetraspanin 6 Calculated Molecular Weight: 245 aa, 28 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC012389 Gene Symbol: TSPAN6 Gene ID (NCBI): 7105 RRID: AB_2213446 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43657 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924