Product Description
Size: 20ul / 150ul
The TBCA (12304-1-AP) by Proteintech is a Polyclonal antibody targeting TBCA in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples
12304-1-AP targets TBCA in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human brain tissue, HeLa cells
Positive IP detected in: HeLa cells
Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:300-1:1500
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2950 Product name: Recombinant human TBCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC018210 Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA Predict reactive species
Full Name: tubulin folding cofactor A
Calculated Molecular Weight: 108 aa, 13 kDa
Observed Molecular Weight: 13 kDa
GenBank Accession Number: BC018210
Gene Symbol: TBCA
Gene ID (NCBI): 6902
RRID: AB_2199402
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O75347
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924