Iright
BRAND / VENDOR: Proteintech

Proteintech, 12306-1-AP, ZFP36L1/2 Polyclonal antibody

CATALOG NUMBER: 12306-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZFP36L1/2 (12306-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP36L1/2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12306-1-AP targets ZFP36L1/2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-937 cells, 3T3-L1 cells, RAW 264.7 cells, HeLa cells Positive IHC detected in: rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZFP36L1, also named as Butyrate response factor 1 or TPA-induced sequence 11b, is a 338 amino acid protein, which is phosphorylated by RPS6KA1 at Ser-334 upon phorbol 12-myristate 13-acetate (PMA) treatment. ZFP36 encodes tristetraprolin (TTP) the prototype of a small family of RBPs, called the ZFP36 family, that are characterised by highly conserved tandem CCCH zinc-finger RNA-binding domains [PMID: 10751406]. ZFP36 is a RBP that promotes RNA decay and negatively regulates the expression of the myogenic regulatory factor MyoD by binding to the 3'UTR of MyoD mRNA [PMID: 25815583]. Mouse satellite cells from Zfp36-deficient mice express increased amounts of MyoD and display impaired satellite activation, demonstrating a role for ZFP36 in the maintenance of quiescence [PMID: 25815583]. The functions of the ZFP36L1 and ZFP36L2 family members have not been evaluated in skeletal muscle stem cell fate, but have been shown to act redundantly to promote quiescence during lymphocyte development. ZFP36L1 has been implicated in the persistence of the marginal zone B lymphocyte population. ZFP36L1 exists three isoform through blasting on NCBI database and can be phosphorylated, so the range of the molecular weight of ZFP36L1 is about 40-50 kDa. (PMID: 26180518, PMID: 17030620). This antibody recognizes both ZFP36L1 and ZFP36L2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2952 Product name: Recombinant human ZFP36L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-338 aa of BC018340 Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD Predict reactive species Full Name: zinc finger protein 36, C3H type-like 1 Calculated Molecular Weight: 338 aa, 36 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC018340 Gene Symbol: ZFP36L1 Gene ID (NCBI): 677 RRID: AB_2737443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924