Iright
BRAND / VENDOR: Proteintech

Proteintech, 12319-2-AP, ACAA1 Polyclonal antibody

CATALOG NUMBER: 12319-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACAA1 (12319-2-AP) by Proteintech is a Polyclonal antibody targeting ACAA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12319-2-AP targets ACAA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, A549 cells, human lung tissue Positive IHC detected in: human thyroid cancer tissue, human lung tissue, human prostate cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ACAA1 (acetyl-CoA acyltransferase 1) is an enzyme involved in lipid β-oxidation and provides substrates to the tricarboxylic acid (TCA) cycle, a critical step in cellular metabolism (PMID:33194642). ACAA1 is also a biomarker in type 2 diabetes (T2D), predicting the pre-diabetic metabolic signature in mouse models (PMID:25784953). Moreover, ACAA1 is highly expressed in TNBC, serving as a potential therapeutic target in ACAA1-high tumors and a predictive biomarker of resistance to CDK4/6 inhibitors for RB1-proficient patients (PMID:37129951). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2972 Product name: Recombinant human ACAA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-424 aa of BC011977 Sequence: STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN Predict reactive species Full Name: acetyl-Coenzyme A acyltransferase 1 Calculated Molecular Weight: 424 aa, 44 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC011977 Gene Symbol: ACAA1 Gene ID (NCBI): 30 RRID: AB_2289045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09110 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924