Iright
BRAND / VENDOR: Proteintech

Proteintech, 12329-1-AP, NUP98-NUP96 Polyclonal antibody

CATALOG NUMBER: 12329-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUP98-NUP96 (12329-1-AP) by Proteintech is a Polyclonal antibody targeting NUP98-NUP96 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12329-1-AP targets NUP98-NUP96 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Nup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2). Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3016 Product name: Recombinant human NUP98-NUP96 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1515-1817 aa of BC012906 Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL Predict reactive species Full Name: nucleoporin 98kDa Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC012906 Gene Symbol: NUP98 Gene ID (NCBI): 4928 RRID: AB_10973678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924